Lineage for d1yfra1 (1yfr A:237-457)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1101582Fold a.203: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101352] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 1101583Superfamily a.203.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101353] (1 family) (S)
  5. 1101584Family a.203.1.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101354] (1 protein)
  6. 1101585Protein Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101355] (1 species)
  7. 1101586Species Aquifex aeolicus [TaxId:63363] [101356] (5 PDB entries)
  8. 1101590Domain d1yfra1: 1yfr A:237-457 [123084]
    Other proteins in same PDB: d1yfra2, d1yfrb2
    automatically matched to d1riqa1
    protein/RNA complex; complexed with atp, mg

Details for d1yfra1

PDB Entry: 1yfr (more details), 2.15 Å

PDB Description: crystal structure of alanyl-trna synthetase in complex with atp and magnesium
PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1yfra1:

Sequence, based on SEQRES records: (download)

>d1yfra1 a.203.1.1 (A:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhfkveakkvkpvyshlkelgktsafvgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1yfra1 a.203.1.1 (A:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhpvyshlkelgktsafvgaaal

SCOPe Domain Coordinates for d1yfra1:

Click to download the PDB-style file with coordinates for d1yfra1.
(The format of our PDB-style files is described here.)

Timeline for d1yfra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yfra2