Lineage for d1yfnd1 (1yfn D:5-111)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680685Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 680686Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) (S)
  5. 680687Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)
  6. 680688Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 680689Species Escherichia coli [TaxId:562] [101741] (3 PDB entries)
  8. 680693Domain d1yfnd1: 1yfn D:5-111 [123083]
    automatically matched to d1ox9a_

Details for d1yfnd1

PDB Entry: 1yfn (more details), 1.8 Å

PDB Description: Versatile modes of peptide recognition by the AAA+ adaptor protein SspB- the crystal structure of a SspB-RseA complex
PDB Compounds: (D:) Stringent starvation protein B

SCOP Domain Sequences for d1yfnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfnd1 b.136.1.1 (D:5-111) Stringent starvation protein B, SspB {Escherichia coli [TaxId: 562]}
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

SCOP Domain Coordinates for d1yfnd1:

Click to download the PDB-style file with coordinates for d1yfnd1.
(The format of our PDB-style files is described here.)

Timeline for d1yfnd1: