Class b: All beta proteins [48724] (178 folds) |
Fold b.136: SspB-like [101737] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
Superfamily b.136.1: SspB-like [101738] (3 families) |
Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins) automatically mapped to Pfam PF04386 |
Protein automated matches [190148] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [186873] (1 PDB entry) |
Domain d1yfnb_: 1yfn B: [123081] automated match to d1ox9a_ |
PDB Entry: 1yfn (more details), 1.8 Å
SCOPe Domain Sequences for d1yfnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yfnb_ b.136.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
Timeline for d1yfnb_: