Lineage for d1yfnb_ (1yfn B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433461Fold b.136: SspB-like [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 2433462Superfamily b.136.1: SspB-like [101738] (3 families) (S)
  5. 2433463Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
    automatically mapped to Pfam PF04386
  6. 2433489Protein automated matches [190148] (1 species)
    not a true protein
  7. 2433490Species Escherichia coli [TaxId:562] [186873] (1 PDB entry)
  8. 2433492Domain d1yfnb_: 1yfn B: [123081]
    automated match to d1ox9a_

Details for d1yfnb_

PDB Entry: 1yfn (more details), 1.8 Å

PDB Description: Versatile modes of peptide recognition by the AAA+ adaptor protein SspB- the crystal structure of a SspB-RseA complex
PDB Compounds: (B:) Stringent starvation protein B

SCOPe Domain Sequences for d1yfnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfnb_ b.136.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

SCOPe Domain Coordinates for d1yfnb_:

Click to download the PDB-style file with coordinates for d1yfnb_.
(The format of our PDB-style files is described here.)

Timeline for d1yfnb_: