SCOP 1.73: Domain d1yfnb1: 1yfn B:5-111

Lineage for d1yfnb1 (1yfn B:5-111)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family)

5. Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)

6. Protein Stringent starvation protein B, SspB [101740] (2 species)
   a specificity-enhancing factor for the ClpXP proteolytic machine

7. Species Escherichia coli [TaxId:562] [101741] (3 PDB entries)

8. Domain d1yfnb1: 1yfn B:5-111 [123081]
   automatically matched to d1ox9a_

Details for d1yfnb1

PDB Entry: 1yfn, 1.8 Å

PDB Description: Versatile modes of peptide recognition by the AAA+ adaptor protein SspB- the crystal structure of a SspB-RseA complex

PDB Compounds: (B:) Stringent starvation protein B

SCOP Domain Sequences for d1yfnb1:

Sequence; same for both SEQRES and ATOM records:

>d1yfnb1 b.136.1.1 (B:5-111) Stringent starvation protein B, SspB {Escherichia coli [TaxId: 562]}
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

Timeline for d1yfnb1:

• d1yfnb1 is new in SCOP 1.73
  
• d1yfnb1 appears in SCOP 1.75
  
• d1yfnb1 appears in the current release, SCOPe 2.08, called d1yfnb_