SCOPe 2.08: Domain d1yfnb_: 1yfn B:

Lineage for d1yfnb_ (1yfn B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.136: SspB-like [101737] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.136.1: SspB-like [101738] (3 families)

5. Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
   automatically mapped to Pfam PF04386

6. Protein automated matches [190148] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186873] (1 PDB entry)

8. Domain d1yfnb_: 1yfn B: [123081]
   automated match to d1ox9a_

Details for d1yfnb_

PDB Entry: 1yfn, 1.8 Å

PDB Description: Versatile modes of peptide recognition by the AAA+ adaptor protein SspB- the crystal structure of a SspB-RseA complex

PDB Compounds: (B:) Stringent starvation protein B

SCOPe Domain Sequences for d1yfnb_:

Sequence; same for both SEQRES and ATOM records:

>d1yfnb_ b.136.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

Timeline for d1yfnb_:

• d1yfnb_ first appeared in SCOP 1.73, called d1yfnb1
  
• d1yfnb_ appears in SCOPe 2.07