Lineage for d1yfna_ (1yfn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824646Fold b.136: SspB-like [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 2824647Superfamily b.136.1: SspB-like [101738] (3 families) (S)
  5. 2824648Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
    automatically mapped to Pfam PF04386
  6. 2824674Protein automated matches [190148] (1 species)
    not a true protein
  7. 2824675Species Escherichia coli [TaxId:562] [186873] (1 PDB entry)
  8. 2824676Domain d1yfna_: 1yfn A: [123080]
    automated match to d1ox9a_

Details for d1yfna_

PDB Entry: 1yfn (more details), 1.8 Å

PDB Description: Versatile modes of peptide recognition by the AAA+ adaptor protein SspB- the crystal structure of a SspB-RseA complex
PDB Compounds: (A:) Stringent starvation protein B

SCOPe Domain Sequences for d1yfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfna_ b.136.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
lsqltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgn
lelandevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

SCOPe Domain Coordinates for d1yfna_:

Click to download the PDB-style file with coordinates for d1yfna_.
(The format of our PDB-style files is described here.)

Timeline for d1yfna_: