Lineage for d1yfld1 (1yfl D:1-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130081Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 protein domains)
    automatically mapped to Pfam PF02086
  6. 2130085Protein DNA methylase T4DAM [102584] (2 species)
  7. 2130086Species Bacteriophage T4 [TaxId:10665] [102585] (5 PDB entries)
  8. 2130098Domain d1yfld1: 1yfl D:1-259 [123078]
    automatically matched to 1YFJ A:1-259
    protein/DNA complex; complexed with sfg

Details for d1yfld1

PDB Entry: 1yfl (more details), 3.09 Å

PDB Description: t4dam in complex with sinefungin and 16-mer oligonucleotide showing semi-specific and specific contact and flipped base
PDB Compounds: (D:) DNA adenine methylase

SCOPe Domain Sequences for d1yfld1:

Sequence, based on SEQRES records: (download)

>d1yfld1 c.66.1.28 (D:1-259) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
fniyhskekngtdevyifn

Sequence, based on observed residues (ATOM records): (download)

>d1yfld1 c.66.1.28 (D:1-259) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyn
gtdevyifn

SCOPe Domain Coordinates for d1yfld1:

Click to download the PDB-style file with coordinates for d1yfld1.
(The format of our PDB-style files is described here.)

Timeline for d1yfld1: