Lineage for d1yflb1 (1yfl B:1-259)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705023Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (2 proteins)
  6. 705027Protein DNA methylase T4DAM [102584] (1 species)
  7. 705028Species Bacteriophage T4 [TaxId:10665] [102585] (5 PDB entries)
  8. 705039Domain d1yflb1: 1yfl B:1-259 [123077]
    automatically matched to 1YFJ A:1-259
    complexed with sfg

Details for d1yflb1

PDB Entry: 1yfl (more details), 3.09 Å

PDB Description: t4dam in complex with sinefungin and 16-mer oligonucleotide showing semi-specific and specific contact and flipped base
PDB Compounds: (B:) DNA adenine methylase

SCOP Domain Sequences for d1yflb1:

Sequence, based on SEQRES records: (download)

>d1yflb1 c.66.1.28 (B:1-259) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
fniyhskekngtdevyifn

Sequence, based on observed residues (ATOM records): (download)

>d1yflb1 c.66.1.28 (B:1-259) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnngtd
evyifn

SCOP Domain Coordinates for d1yflb1:

Click to download the PDB-style file with coordinates for d1yflb1.
(The format of our PDB-style files is described here.)

Timeline for d1yflb1: