Lineage for d1yfjc_ (1yfj C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893811Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 proteins)
    automatically mapped to Pfam PF02086
  6. 2893815Protein DNA methylase T4DAM [102584] (2 species)
  7. 2893816Species Bacteriophage T4 [TaxId:10665] [102585] (5 PDB entries)
  8. 2893822Domain d1yfjc_: 1yfj C: [123072]
    automated match to d1q0sa_
    protein/DNA complex; complexed with ca, cl, sah

Details for d1yfjc_

PDB Entry: 1yfj (more details), 2.69 Å

PDB Description: t4dam in complex with adohcy and 15-mer oligonucleotide showing semi- specific and specific contact
PDB Compounds: (C:) DNA adenine methylase

SCOPe Domain Sequences for d1yfjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfjc_ c.66.1.28 (C:) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
fniyhskekngtdevyifn

SCOPe Domain Coordinates for d1yfjc_:

Click to download the PDB-style file with coordinates for d1yfjc_.
(The format of our PDB-style files is described here.)

Timeline for d1yfjc_: