Lineage for d1yfib_ (1yfi B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856866Family c.52.1.23: Restriction endonuclease MspI [110624] (1 protein)
    automatically mapped to Pfam PF09208
  6. 1856867Protein Restriction endonuclease MspI [110625] (1 species)
  7. 1856868Species Moraxella sp. [TaxId:479] [110626] (2 PDB entries)
    Uniprot P11405
  8. 1856872Domain d1yfib_: 1yfi B: [123069]
    automated match to d1sa3a_
    protein/DNA complex

Details for d1yfib_

PDB Entry: 1yfi (more details), 2.7 Å

PDB Description: Crystal Structure of restriction endonuclease MspI in complex with its cognate DNA in P212121 space group
PDB Compounds: (B:) Type II restriction enzyme MspI

SCOPe Domain Sequences for d1yfib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfib_ c.52.1.23 (B:) Restriction endonuclease MspI {Moraxella sp. [TaxId: 479]}
mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
fgtglnwtyasgskakkmqfkg

SCOPe Domain Coordinates for d1yfib_:

Click to download the PDB-style file with coordinates for d1yfib_.
(The format of our PDB-style files is described here.)

Timeline for d1yfib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yfia_