Lineage for d1yfia_ (1yfi A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882629Family c.52.1.23: Restriction endonuclease MspI [110624] (1 protein)
    automatically mapped to Pfam PF09208
  6. 2882630Protein Restriction endonuclease MspI [110625] (1 species)
  7. 2882631Species Moraxella sp. [TaxId:479] [110626] (2 PDB entries)
    Uniprot P11405
  8. 2882634Domain d1yfia_: 1yfi A: [123068]
    automated match to d1sa3a_
    protein/DNA complex

Details for d1yfia_

PDB Entry: 1yfi (more details), 2.7 Å

PDB Description: Crystal Structure of restriction endonuclease MspI in complex with its cognate DNA in P212121 space group
PDB Compounds: (A:) Type II restriction enzyme MspI

SCOPe Domain Sequences for d1yfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfia_ c.52.1.23 (A:) Restriction endonuclease MspI {Moraxella sp. [TaxId: 479]}
mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
fgtglnwtyasgskakkmqfkg

SCOPe Domain Coordinates for d1yfia_:

Click to download the PDB-style file with coordinates for d1yfia_.
(The format of our PDB-style files is described here.)

Timeline for d1yfia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yfib_