Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family) |
Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins) |
Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries) |
Domain d1yfhb2: 1yfh B:5-91 [123065] Other proteins in same PDB: d1yfha1, d1yfhb1, d1yfhc1 automatically matched to d1eh6a2 complexed with xcy, zn |
PDB Entry: 1yfh (more details), 3.01 Å
SCOP Domain Sequences for d1yfhb2:
Sequence, based on SEQRES records: (download)
>d1yfhb2 c.55.7.1 (B:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta wlnayfhqpeaieefpvpalhhpvfqq
>d1yfhb2 c.55.7.1 (B:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} cemkrttldsplgklelsgceqglheikllgvpapaavlggpeplmqctawlnayfhqpe aieefpvpalhhpvfqq
Timeline for d1yfhb2:
View in 3D Domains from other chains: (mouse over for more information) d1yfha1, d1yfha2, d1yfhc1, d1yfhc2 |