Lineage for d1yfhb1 (1yfh B:92-175)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761830Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (1 family) (S)
  5. 761831Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)
  6. 761835Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)
  7. 761838Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries)
    Uniprot P16455 6-176
  8. 761844Domain d1yfhb1: 1yfh B:92-175 [123064]
    Other proteins in same PDB: d1yfha2, d1yfhb2, d1yfhc2
    automatically matched to d1eh6a1
    complexed with xcy, zn

Details for d1yfhb1

PDB Entry: 1yfh (more details), 3.01 Å

PDB Description: wt Human O6-Alkylguanine-DNA Alkyltransferase Bound To DNA Containing an Alkylated Cytosine
PDB Compounds: (B:) methylated-DNA--protein-cysteine methyltransferase

SCOP Domain Sequences for d1yfhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfhb1 a.4.2.1 (B:92-175) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghr

SCOP Domain Coordinates for d1yfhb1:

Click to download the PDB-style file with coordinates for d1yfhb1.
(The format of our PDB-style files is described here.)

Timeline for d1yfhb1: