Lineage for d1yfha1 (1yfh A:92-179)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982136Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) (S)
    automatically mapped to Pfam PF01035
  5. 1982137Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 protein domains)
  6. 1982141Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)
  7. 1982142Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries)
    Uniprot P16455 6-176
  8. 1982147Domain d1yfha1: 1yfh A:92-179 [123062]
    Other proteins in same PDB: d1yfha2, d1yfhb2, d1yfhc2
    automatically matched to d1eh6a1
    protein/DNA complex; complexed with zn

Details for d1yfha1

PDB Entry: 1yfh (more details), 3.01 Å

PDB Description: wt Human O6-Alkylguanine-DNA Alkyltransferase Bound To DNA Containing an Alkylated Cytosine
PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1yfha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfha1 a.4.2.1 (A:92-179) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghrlgkp

SCOPe Domain Coordinates for d1yfha1:

Click to download the PDB-style file with coordinates for d1yfha1.
(The format of our PDB-style files is described here.)

Timeline for d1yfha1: