Lineage for d1yfea_ (1yfe A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010373Protein automated matches [190147] (7 species)
    not a true protein
  7. 2010384Species Escherichia coli K-12 [TaxId:83333] [186872] (1 PDB entry)
  8. 2010385Domain d1yfea_: 1yfe A: [123061]
    automated match to d1fuob_

Details for d1yfea_

PDB Entry: 1yfe (more details), 2.19 Å

PDB Description: Crystal structure of apo fumarase C from Escherichia coli
PDB Compounds: (A:) fumarate hydratase class II

SCOPe Domain Sequences for d1yfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfea_ a.127.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
merkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
igrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
iakkahkegltlkaaalalgylseaefdswvrpeqmv

SCOPe Domain Coordinates for d1yfea_:

Click to download the PDB-style file with coordinates for d1yfea_.
(The format of our PDB-style files is described here.)

Timeline for d1yfea_: