Lineage for d1yfdb_ (1yfd B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990178Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 1990212Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 1990224Domain d1yfdb_: 1yfd B: [123060]
    automated match to d1yfda1
    complexed with feo, hg; mutant

Details for d1yfdb_

PDB Entry: 1yfd (more details), 1.9 Å

PDB Description: Crystal structure of the Y122H mutant of ribonucleotide reductase R2 protein from E. coli
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOPe Domain Sequences for d1yfdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfdb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
shthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

SCOPe Domain Coordinates for d1yfdb_:

Click to download the PDB-style file with coordinates for d1yfdb_.
(The format of our PDB-style files is described here.)

Timeline for d1yfdb_: