![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.129: Double-split beta-barrel [89446] (2 superfamilies) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) ![]() members of this superfamily are known or predicted to have DNA-binding function |
![]() | Family b.129.1.3: AbrB N-terminal domain-like [54743] (2 proteins) dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ |
![]() | Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [54745] (3 PDB entries) |
![]() | Domain d1yfbb1: 1yfb B:3-53 [123058] automatically matched to d1ekta_ |
PDB Entry: 1yfb (more details)
SCOPe Domain Sequences for d1yfbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yfbb1 b.129.1.3 (B:3-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]} mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn
Timeline for d1yfbb1: