Lineage for d1yfbb1 (1yfb B:3-53)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680573Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 680574Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 680602Family b.129.1.3: Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54743] (1 protein)
    dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
  6. 680603Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species)
  7. 680604Species Bacillus subtilis [TaxId:1423] [54745] (3 PDB entries)
  8. 680606Domain d1yfbb1: 1yfb B:3-53 [123058]
    automatically matched to d1ekta_

Details for d1yfbb1

PDB Entry: 1yfb (more details)

PDB Description: The solution structure of the N-domain of the transcription factor abrB
PDB Compounds: (B:) Transition state regulatory protein abrB

SCOP Domain Sequences for d1yfbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfbb1 b.129.1.3 (B:3-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn

SCOP Domain Coordinates for d1yfbb1:

Click to download the PDB-style file with coordinates for d1yfbb1.
(The format of our PDB-style files is described here.)

Timeline for d1yfbb1:

Domains from other chains:
(mouse over for more information)
d1yfba1