Lineage for d1yfbb_ (1yfb B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824469Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2824470Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 2824502Family b.129.1.3: AbrB N-terminal domain-like [54743] (3 proteins)
    dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
    automatically mapped to Pfam PF04014
  6. 2824509Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species)
  7. 2824510Species Bacillus subtilis [TaxId:1423] [54745] (5 PDB entries)
  8. 2824512Domain d1yfbb_: 1yfb B: [123058]
    automated match to d1z0ra1

Details for d1yfbb_

PDB Entry: 1yfb (more details)

PDB Description: the solution structure of the n-domain of the transcription factor abrb
PDB Compounds: (B:) Transition state regulatory protein abrB

SCOPe Domain Sequences for d1yfbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfbb_ b.129.1.3 (B:) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
fmkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn

SCOPe Domain Coordinates for d1yfbb_:

Click to download the PDB-style file with coordinates for d1yfbb_.
(The format of our PDB-style files is described here.)

Timeline for d1yfbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yfba_