| Class b: All beta proteins [48724] (174 folds) |
| Fold b.129: Double-split beta-barrel [89446] (2 superfamilies) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) ![]() members of this superfamily are known or predicted to have DNA-binding function |
| Family b.129.1.3: AbrB N-terminal domain-like [54743] (2 proteins) dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ |
| Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [54745] (3 PDB entries) |
| Domain d1yfba1: 1yfb A:3-53 [123057] automatically matched to d1ekta_ |
PDB Entry: 1yfb (more details)
SCOP Domain Sequences for d1yfba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yfba1 b.129.1.3 (A:3-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn
Timeline for d1yfba1: