SCOPe 2.08: Domain d1yfba_: 1yfb A:

Lineage for d1yfba_ (1yfb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.3: AbrB N-terminal domain-like [54743] (3 proteins)
   dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
   automatically mapped to Pfam PF04014

6. Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [54745] (5 PDB entries)

8. Domain d1yfba_: 1yfb A: [123057]
   automated match to d1z0ra1

Details for d1yfba_

PDB Entry: 1yfb

PDB Description: the solution structure of the n-domain of the transcription factor abrb

PDB Compounds: (A:) Transition state regulatory protein abrB

SCOPe Domain Sequences for d1yfba_:

Sequence; same for both SEQRES and ATOM records:

>d1yfba_ b.129.1.3 (A:) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
fmkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn

Timeline for d1yfba_:

• d1yfba_ first appeared in SCOP 1.73, called d1yfba1
  
• d1yfba_ appears in SCOPe 2.07