SCOP 1.73: Domain d1yf9c1: 1yf9 C:13-170

Lineage for d1yf9c1 (1yf9 C:13-170)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)

7. Species Leishmania major [TaxId:5664] [143049] (1 PDB entry)
   Ubiquitin carrier protein 4, putative

8. Domain d1yf9c1: 1yf9 C:13-170 [123056]
   automatically matched to 1YF9 A:13-170
   complexed with cl

Details for d1yf9c1

PDB Entry: 1yf9, 2 Å

PDB Description: Structural analysis of Leishmania major ubiquitin conjugating enzyme E2

PDB Compounds: (C:) Ubiquitin carrier protein 4

SCOP Domain Sequences for d1yf9c1:

Sequence; same for both SEQRES and ATOM records:

>d1yf9c1 d.20.1.1 (C:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]}
snrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfksp
sigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnvqa
ahllhadrvgfdallrehvsthatpqkalesipeayrp

Timeline for d1yf9c1:

• d1yf9c1 is new in SCOP 1.73
  
• d1yf9c1 appears in SCOP 1.75
  
• d1yf9c1 appears in the current release, SCOPe 2.08, called d1yf9c_