Lineage for d1yf9b_ (1yf9 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642988Protein automated matches [190124] (12 species)
    not a true protein
  7. 1643067Species Leishmania major [TaxId:5664] [188133] (1 PDB entry)
  8. 1643068Domain d1yf9b_: 1yf9 B: [123055]
    Other proteins in same PDB: d1yf9a1
    automated match to d1yf9a1
    complexed with cl

Details for d1yf9b_

PDB Entry: 1yf9 (more details), 2 Å

PDB Description: Structural analysis of Leishmania major ubiquitin conjugating enzyme E2
PDB Compounds: (B:) Ubiquitin carrier protein 4

SCOPe Domain Sequences for d1yf9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf9b_ d.20.1.1 (B:) automated matches {Leishmania major [TaxId: 5664]}
lrsnrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfk
spsigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnv
qaahllhadrvgfdallrehvsthatpqkalesipeayrp

SCOPe Domain Coordinates for d1yf9b_:

Click to download the PDB-style file with coordinates for d1yf9b_.
(The format of our PDB-style files is described here.)

Timeline for d1yf9b_: