![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (13 species) not a true protein |
![]() | Species Leishmania major [TaxId:5664] [188133] (1 PDB entry) |
![]() | Domain d1yf9b_: 1yf9 B: [123055] Other proteins in same PDB: d1yf9a1 automated match to d1yf9a1 complexed with cl |
PDB Entry: 1yf9 (more details), 2 Å
SCOPe Domain Sequences for d1yf9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yf9b_ d.20.1.1 (B:) automated matches {Leishmania major [TaxId: 5664]} lrsnrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfk spsigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnv qaahllhadrvgfdallrehvsthatpqkalesipeayrp
Timeline for d1yf9b_: