Lineage for d1yf8b1 (1yf8 B:1-133)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669060Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 669245Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 669246Family b.42.2.1: Ricin B-like [50371] (7 proteins)
  6. 669271Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 669282Species European mistletoe (Viscum album) [TaxId:3972] [50375] (11 PDB entries)
    different sequence variants
  8. 669295Domain d1yf8b1: 1yf8 B:1-133 [123052]
    Other proteins in same PDB: d1yf8a1
    automatically matched to d1pc8b1
    complexed with gal, glc, man, nag, p6c

Details for d1yf8b1

PDB Entry: 1yf8 (more details), 2.8 Å

PDB Description: Crystal structure of Himalayan mistletoe RIP reveals the presence of a natural inhibitor and a new functionally active sugar-binding site
PDB Compounds: (B:) Himalayan mistletoe ribosome-inactivating protein

SCOP Domain Sequences for d1yf8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf8b1 b.42.2.1 (B:1-133) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
dytlgqgwlagnd

SCOP Domain Coordinates for d1yf8b1:

Click to download the PDB-style file with coordinates for d1yf8b1.
(The format of our PDB-style files is described here.)

Timeline for d1yf8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yf8b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1yf8a1