SCOPe 2.01: Domain d1yf8a_: 1yf8 A:

Lineage for d1yf8a_ (1yf8 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Mistletoe lectin I A-chain [56381] (1 species)

7. Species European mistletoe (Viscum album) [TaxId:3972] [56382] (11 PDB entries)
   different sequence variants
   Uniprot P81446 1-249
   Uniprot Q6ITZ3 1-240

8. Domain d1yf8a_: 1yf8 A: [123051]
   Other proteins in same PDB: d1yf8b1, d1yf8b2
   automated match to d1pc8a_
   complexed with gal, nag, p6c

Details for d1yf8a_

PDB Entry: 1yf8, 2.8 Å

PDB Description: crystal structure of himalayan mistletoe rip reveals the presence of a natural inhibitor and a new functionally active sugar-binding site

PDB Compounds: (A:) Beta-galactoside-specific lectin 4

SCOPe Domain Sequences for d1yf8a_:

Sequence; same for both SEQRES and ATOM records:

>d1yf8a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc

Timeline for d1yf8a_:

• d1yf8a_ first appeared in SCOP 1.73, called d1yf8a1
  
• d1yf8a_ was called d1yf8a1 in SCOP 1.75
  
• d1yf8a_ appears in SCOPe 2.02
  
• d1yf8a_ appears in the current release, SCOPe 2.08