Lineage for d1yf8a_ (1yf8 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2557740Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2557741Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2557742Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2557814Protein Mistletoe lectin I A-chain [56381] (1 species)
  7. 2557815Species European mistletoe (Viscum album) [TaxId:3972] [56382] (12 PDB entries)
    different sequence variants
    Uniprot P81446 1-249
    Uniprot Q6ITZ3 1-240
  8. 2557823Domain d1yf8a_: 1yf8 A: [123051]
    Other proteins in same PDB: d1yf8b1, d1yf8b2
    automated match to d1pc8a_
    complexed with gal, nag, p6c

Details for d1yf8a_

PDB Entry: 1yf8 (more details), 2.8 Å

PDB Description: Crystal structure of Himalayan mistletoe RIP reveals the presence of a natural inhibitor and a new functionally active sugar-binding site
PDB Compounds: (A:) Beta-galactoside-specific lectin 4

SCOPe Domain Sequences for d1yf8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf8a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc

SCOPe Domain Coordinates for d1yf8a_:

Click to download the PDB-style file with coordinates for d1yf8a_.
(The format of our PDB-style files is described here.)

Timeline for d1yf8a_: