SCOPe 2.08: Domain d1yf5l2: 1yf5 L:2-145

Lineage for d1yf5l2 (1yf5 L:2-145)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.11: Cyto-EpsL domain [117644] (2 proteins)
   N-terminal part of Pfam PF05134
6. Protein Cytoplasmic domain of general secretion pathway protein L, EpsL [117645] (1 species)
7. Species Vibrio cholerae [TaxId:666] [117646] (2 PDB entries)
   Uniprot P45782 6-244

8. Domain d1yf5l2: 1yf5 L:2-145 [123050]

Details for d1yf5l2

PDB Entry: 1yf5, 2.75 Å

PDB Description: Cyto-Epsl: The Cytoplasmic Domain Of Epsl, An Inner Membrane Component Of The Type II Secretion System Of Vibrio Cholerae

PDB Compounds: (L:) general secretion pathway protein l

SCOPe Domain Sequences for d1yf5l2:

Sequence; same for both SEQRES and ATOM records:

>d1yf5l2 c.55.1.11 (L:2-145) Cytoplasmic domain of general secretion pathway protein L, EpsL {Vibrio cholerae [TaxId: 666]}
sefltvrlssqkeadipwlvwsaeqqeviasgqvagwealheiesyadqrsvvvllaasd
liltsveippgasrqlenmlpylledeiaqdvedvhfcvlskgretadvvgvdrlwlrac
ldhlkacgfdvkrvlpdvlaiprp

Timeline for d1yf5l2:

• d1yf5l2 first appeared in SCOP 1.73
  
• d1yf5l2 appears in SCOPe 2.07