Lineage for d1yf2b1 (1yf2 B:1-220)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882033Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 882034Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 882060Family d.287.1.2: Type I restriction modification DNA specificity domain [143979] (2 proteins)
    Pfam PF01420
  6. 882065Protein Bipartite methylase S protein MJ0130 [143982] (1 species)
    duplication: comprises two repeats of this domain, separated by a coiled coil made by additional long helices at the C-end of each repeat
  7. 882066Species Methanocaldococcus jannaschii [TaxId:2190] [143983] (1 PDB entry)
    Uniprot Q57594 1-220! Uniprot Q57594 221-425
  8. 882069Domain d1yf2b1: 1yf2 B:1-220 [123044]
    automatically matched to 1YF2 A:1-220

Details for d1yf2b1

PDB Entry: 1yf2 (more details), 2.4 Å

PDB Description: Three-dimensional structure of DNA sequence specificity (S) subunit of a type I restriction-modification enzyme and its functional implications
PDB Compounds: (B:) Type I restriction-modification enzyme, S subunit

SCOP Domain Sequences for d1yf2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf2b1 d.287.1.2 (B:1-220) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]}
mfykeenfkkteigeipedweivelkdvckkikaggtpktsveeyykngtipfvkiedit
nsnkyltntkikiteeglnnsnawivpknsvlfamygsigetainkievatnqailgiip
kdnileseflyyilaknknyysklgmqttqknlnaqivksfkiplppleeqkqiakiltk
idegieiieksinklerikkglmhklltkgighsrfkkse

SCOP Domain Coordinates for d1yf2b1:

Click to download the PDB-style file with coordinates for d1yf2b1.
(The format of our PDB-style files is described here.)

Timeline for d1yf2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yf2b2