SCOPe 2.08: Domain d1yf2b1: 1yf2 B:1-220

Lineage for d1yf2b1 (1yf2 B:1-220)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.2: Type I restriction modification DNA specificity domain [143979] (2 proteins)
   Pfam PF01420

6. Protein Bipartite methylase S protein MJ0130 [143982] (1 species)
   duplication: comprises two repeats of this domain, separated by a coiled coil made by additional long helices at the C-end of each repeat

7. Species Methanocaldococcus jannaschii [TaxId:2190] [143983] (1 PDB entry)
   Uniprot Q57594 1-220! Uniprot Q57594 221-425

8. Domain d1yf2b1: 1yf2 B:1-220 [123044]
   automated match to d1yf2a1

Details for d1yf2b1

PDB Entry: 1yf2, 2.4 Å

PDB Description: Three-dimensional structure of DNA sequence specificity (S) subunit of a type I restriction-modification enzyme and its functional implications

PDB Compounds: (B:) Type I restriction-modification enzyme, S subunit

SCOPe Domain Sequences for d1yf2b1:

Sequence; same for both SEQRES and ATOM records:

>d1yf2b1 d.287.1.2 (B:1-220) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]}
mfykeenfkkteigeipedweivelkdvckkikaggtpktsveeyykngtipfvkiedit
nsnkyltntkikiteeglnnsnawivpknsvlfamygsigetainkievatnqailgiip
kdnileseflyyilaknknyysklgmqttqknlnaqivksfkiplppleeqkqiakiltk
idegieiieksinklerikkglmhklltkgighsrfkkse

Timeline for d1yf2b1:

• d1yf2b1 first appeared in SCOP 1.73
  
• d1yf2b1 appears in SCOPe 2.07