| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.287: DNA methylase specificity domain [116733] (1 superfamily) comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin |
Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) ![]() |
| Family d.287.1.2: Type I restriction modification DNA specificity domain [143979] (2 proteins) Pfam PF01420 |
| Protein Bipartite methylase S protein MJ0130 [143982] (1 species) duplication: comprises two repeats of this domain, separated by a coiled coil made by additional long helices at the C-end of each repeat |
| Species Methanocaldococcus jannaschii [TaxId:2190] [143983] (1 PDB entry) Uniprot Q57594 1-220! Uniprot Q57594 221-425 |
| Domain d1yf2a1: 1yf2 A:1-220 [123042] |
PDB Entry: 1yf2 (more details), 2.4 Å
SCOP Domain Sequences for d1yf2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yf2a1 d.287.1.2 (A:1-220) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]}
mfykeenfkkteigeipedweivelkdvckkikaggtpktsveeyykngtipfvkiedit
nsnkyltntkikiteeglnnsnawivpknsvlfamygsigetainkievatnqailgiip
kdnileseflyyilaknknyysklgmqttqknlnaqivksfkiplppleeqkqiakiltk
idegieiieksinklerikkglmhklltkgighsrfkkse
Timeline for d1yf2a1: