Lineage for d1yf1e_ (1yf1 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877472Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)
  7. 2877530Species Salmonella typhimurium [TaxId:90371] [69517] (6 PDB entries)
  8. 2877574Domain d1yf1e_: 1yf1 E: [123036]
    automated match to d1n8ja_
    complexed with na

Details for d1yf1e_

PDB Entry: 1yf1 (more details), 2.6 Å

PDB Description: structural and biochemical analysis of the link between enzymatic activity and oligomerization in ahpc, a bacterial peroxiredoxin.
PDB Compounds: (E:) Alkyl hydroperoxide reductase subunit C

SCOPe Domain Sequences for d1yf1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf1e_ c.47.1.10 (E:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc

SCOPe Domain Coordinates for d1yf1e_:

Click to download the PDB-style file with coordinates for d1yf1e_.
(The format of our PDB-style files is described here.)

Timeline for d1yf1e_: