Lineage for d1yf1b1 (1yf1 B:1-165)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 834330Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 834343Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species)
  7. 834359Species Salmonella typhimurium [TaxId:90371] [69517] (5 PDB entries)
  8. 834396Domain d1yf1b1: 1yf1 B:1-165 [123033]
    automatically matched to 1YF1 A:1-166
    complexed with na; mutant

Details for d1yf1b1

PDB Entry: 1yf1 (more details), 2.6 Å

PDB Description: structural and biochemical analysis of the link between enzymatic activity and oligomerization in ahpc, a bacterial peroxiredoxin.
PDB Compounds: (B:) Alkyl hydroperoxide reductase subunit C

SCOP Domain Sequences for d1yf1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf1b1 c.47.1.10 (B:1-165) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc

SCOP Domain Coordinates for d1yf1b1:

Click to download the PDB-style file with coordinates for d1yf1b1.
(The format of our PDB-style files is described here.)

Timeline for d1yf1b1: