| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
| Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species) |
| Species Salmonella typhimurium [TaxId:90371] [69517] (5 PDB entries) |
| Domain d1yf1a1: 1yf1 A:1-166 [123032] complexed with na; mutant |
PDB Entry: 1yf1 (more details), 2.6 Å
SCOP Domain Sequences for d1yf1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yf1a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 602]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp
Timeline for d1yf1a1: