SCOPe 2.08: Domain d1yf0b_: 1yf0 B:

Lineage for d1yf0b_ (1yf0 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)

7. Species Salmonella typhimurium [TaxId:90371] [69517] (6 PDB entries)

8. Domain d1yf0b_: 1yf0 B: [123028]
   automated match to d1n8ja_
   complexed with so4

Details for d1yf0b_

PDB Entry: 1yf0, 2.5 Å

PDB Description: structural and biochemical analysis of the link between enzymatic activity and oligomerization in ahpc, a bacterial peroxiredoxin.

PDB Compounds: (B:) Alkyl hydroperoxide reductase subunit C

SCOPe Domain Sequences for d1yf0b_:

Sequence; same for both SEQRES and ATOM records:

>d1yf0b_ c.47.1.10 (B:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfihkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc

Timeline for d1yf0b_:

• d1yf0b_ first appeared in SCOP 1.73, called d1yf0b1
  
• d1yf0b_ appears in SCOPe 2.07