Lineage for d1yeza1 (1yez A:1-68)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399951Family b.40.4.12: TRAM domain [101768] (3 proteins)
    Pfam PF01938
  6. 2399952Protein Hypothetical protein MM1357 [141311] (1 species)
  7. 2399953Species Methanosarcina mazei [TaxId:2209] [141312] (1 PDB entry)
    Uniprot Q8PX65 1-68
  8. 2399954Domain d1yeza1: 1yez A:1-68 [123026]

Details for d1yeza1

PDB Entry: 1yez (more details)

PDB Description: Solution structure of the conserved protein from the gene locus MM1357 of Methanosarcina mazei. Northeast Structural Genomics target MaR30.
PDB Compounds: (A:) mm1357

SCOPe Domain Sequences for d1yeza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeza1 b.40.4.12 (A:1-68) Hypothetical protein MM1357 {Methanosarcina mazei [TaxId: 2209]}
mfreesrsvpveegevydvtiqdiarqgdgiariegfvifvpgtkvgdevrikvervlpk
fafasvve

SCOPe Domain Coordinates for d1yeza1:

Click to download the PDB-style file with coordinates for d1yeza1.
(The format of our PDB-style files is described here.)

Timeline for d1yeza1: