SCOP 1.73: Domain d1yexe1: 1yex E:1-165

Lineage for d1yexe1 (1yex E:1-165)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)

6. Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [69517] (5 PDB entries)

8. Domain d1yexe1: 1yex E:1-165 [123025]
   automatically matched to 1YEX A:1-166
   complexed with so4; mutant

Details for d1yexe1

PDB Entry: 1yex, 2.3 Å

PDB Description: structural and biochemical analysis of the link between enzymatic activity and oligomerization in ahpc, a bacterial peroxiredoxin.

PDB Compounds: (E:) Alkyl hydroperoxide reductase subunit C

SCOP Domain Sequences for d1yexe1:

Sequence; same for both SEQRES and ATOM records:

>d1yexe1 c.47.1.10 (E:1-165) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 602]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfdhkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc

Timeline for d1yexe1:

• d1yexe1 is new in SCOP 1.73
  
• d1yexe1 appears in SCOP 1.75
  
• d1yexe1 appears in the current release, SCOPe 2.08, called d1yexe_