Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Alkyl hydroperoxide reductase AhpC [69516] (4 species) |
Species Salmonella typhimurium [TaxId:90371] [69517] (6 PDB entries) |
Domain d1yexd_: 1yex D: [123024] automated match to d1n8ja_ complexed with so4 |
PDB Entry: 1yex (more details), 2.3 Å
SCOPe Domain Sequences for d1yexd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yexd_ c.47.1.10 (D:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel qklgvdvysvstdthfdhkawhsssetiakikyamigdptgaltrnfdnmredegladra tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp
Timeline for d1yexd_:
View in 3D Domains from other chains: (mouse over for more information) d1yexa1, d1yexb_, d1yexc_, d1yexe_ |