![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [69517] (6 PDB entries) |
![]() | Domain d1yepe_: 1yep E: [123020] automated match to d1n8ja_ complexed with so4 |
PDB Entry: 1yep (more details), 2.5 Å
SCOPe Domain Sequences for d1yepe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yepe_ c.47.1.10 (E:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc
Timeline for d1yepe_:
![]() Domains from other chains: (mouse over for more information) d1yepa_, d1yepb_, d1yepc_, d1yepd_ |