![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (22 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries) |
![]() | Domain d1yeod1: 1yeo D:1-146 [123015] Other proteins in same PDB: d1yeoa1, d1yeoc1 automatically matched to d1a01b_ complexed with hem, oxy; mutant |
PDB Entry: 1yeo (more details), 2.22 Å
SCOP Domain Sequences for d1yeod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yeod1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} mhltpeeksavtalwgkvnvdevggealgrllvvypatqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1yeod1: