Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (291 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d1yeoc_: 1yeo C: [123014] Other proteins in same PDB: d1yeob_, d1yeod_ automated match to d1a00a_ complexed with hem, oxy |
PDB Entry: 1yeo (more details), 2.22 Å
SCOPe Domain Sequences for d1yeoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yeoc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1yeoc_: