Lineage for d1yela1 (1yel A:1-102)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433702Fold b.142: DNA-binding pseudobarrel domain [101935] (1 superfamily)
    core: barrel, open; n=7, S*=10; capped with helices at both ends; partial similarity to the AbrB/MazE/MraZ-like fold (89446)
  4. 2433703Superfamily b.142.1: DNA-binding pseudobarrel domain [101936] (2 families) (S)
  5. 2433709Family b.142.1.2: B3 DNA binding domain [117343] (3 proteins)
    Pfam PF02362
  6. 2433710Protein At1g16640 [141692] (1 species)
  7. 2433711Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141693] (1 PDB entry)
    Uniprot Q9FX77 1-102
  8. 2433712Domain d1yela1: 1yel A:1-102 [123011]

Details for d1yela1

PDB Entry: 1yel (more details)

PDB Description: structure of the hypothetical arabidopsis thaliana protein at1g16640.1
PDB Compounds: (A:) At1g16640

SCOPe Domain Sequences for d1yela1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yela1 b.142.1.2 (A:1-102) At1g16640 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
madtgevqfmkpfisekssksleiplgfneyfpapfpitvdlldysgrswtvrmkkrgek
vfltvgwenfvkdnnledgkylqfiydrdrtfyviiyghnmc

SCOPe Domain Coordinates for d1yela1:

Click to download the PDB-style file with coordinates for d1yela1.
(The format of our PDB-style files is described here.)

Timeline for d1yela1: