![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.142: DNA-binding pseudobarrel domain [101935] (1 superfamily) core: barrel, open; n=7, S*=10; capped with helices at both ends; partial similarity to the AbrB/MazE/MraZ-like fold (89446) |
![]() | Superfamily b.142.1: DNA-binding pseudobarrel domain [101936] (2 families) ![]() |
![]() | Family b.142.1.2: B3 DNA binding domain [117343] (3 proteins) Pfam PF02362 |
![]() | Protein At1g16640 [141692] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141693] (1 PDB entry) Uniprot Q9FX77 1-102 |
![]() | Domain d1yela1: 1yel A:1-102 [123011] |
PDB Entry: 1yel (more details)
SCOPe Domain Sequences for d1yela1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yela1 b.142.1.2 (A:1-102) At1g16640 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} madtgevqfmkpfisekssksleiplgfneyfpapfpitvdlldysgrswtvrmkkrgek vfltvgwenfvkdnnledgkylqfiydrdrtfyviiyghnmc
Timeline for d1yela1: