SCOPe 2.06: Domain d1yela1: 1yel A:1-102

Lineage for d1yela1 (1yel A:1-102)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.142: DNA-binding pseudobarrel domain [101935] (1 superfamily)
   core: barrel, open; n=7, S*=10; capped with helices at both ends; partial similarity to the AbrB/MazE/MraZ-like fold (89446)

4. Superfamily b.142.1: DNA-binding pseudobarrel domain [101936] (2 families)

5. Family b.142.1.2: B3 DNA binding domain [117343] (2 proteins)
   Pfam PF02362

6. Protein At1g16640 [141692] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141693] (1 PDB entry)
   Uniprot Q9FX77 1-102

8. Domain d1yela1: 1yel A:1-102 [123011]

Details for d1yela1

PDB Entry: 1yel

PDB Description: structure of the hypothetical arabidopsis thaliana protein at1g16640.1

PDB Compounds: (A:) At1g16640

SCOPe Domain Sequences for d1yela1:

Sequence; same for both SEQRES and ATOM records:

>d1yela1 b.142.1.2 (A:1-102) At1g16640 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
madtgevqfmkpfisekssksleiplgfneyfpapfpitvdlldysgrswtvrmkkrgek
vfltvgwenfvkdnnledgkylqfiydrdrtfyviiyghnmc

Timeline for d1yela1:

• d1yela1 first appeared in SCOP 1.73
  
• d1yela1 appears in SCOPe 2.05
  
• d1yela1 appears in SCOPe 2.07
  
• d1yela1 appears in the current release, SCOPe 2.08