![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
![]() | Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
![]() | Protein Hypothetical protein PH0500 [142112] (2 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142113] (2 PDB entries) Uniprot O58236 2-149 |
![]() | Domain d1ye5b_: 1ye5 B: [123009] automated match to d1v96a1 |
PDB Entry: 1ye5 (more details), 2 Å
SCOPe Domain Sequences for d1ye5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ye5b_ c.120.1.1 (B:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 53953]} plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye pirrfgldtmpldkfikevelmvekel
Timeline for d1ye5b_: