SCOP 1.73: Domain d1ye5a1: 1ye5 A:2-143

Lineage for d1ye5a1 (1ye5 A:2-143)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (2 families)

5. Family c.120.1.1: PIN domain [89619] (7 proteins)
   Pfam PF01850

6. Protein Hypothetical protein PH0500 [142112] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142113] (2 PDB entries)

8. Domain d1ye5a1: 1ye5 A:2-143 [123008]
   automatically matched to 1V96 A:2-149

Details for d1ye5a1

PDB Entry: 1ye5, 2 Å

PDB Description: Crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii OT3

PDB Compounds: (A:) hypothetical protein PH0500

SCOP Domain Sequences for d1ye5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ye5a1 c.120.1.1 (A:2-143) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 53953]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelm

Timeline for d1ye5a1:

• d1ye5a1 is new in SCOP 1.73
  
• d1ye5a1 appears in SCOP 1.75
  
• d1ye5a1 appears in the current release, SCOPe 2.08, called d1ye5a_