Lineage for d1ye5a_ (1ye5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921860Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2921898Protein Hypothetical protein PH0500 [142112] (2 species)
  7. 2921899Species Pyrococcus horikoshii [TaxId:53953] [142113] (2 PDB entries)
    Uniprot O58236 2-149
  8. 2921902Domain d1ye5a_: 1ye5 A: [123008]
    automated match to d1v96a1

Details for d1ye5a_

PDB Entry: 1ye5 (more details), 2 Å

PDB Description: Crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH0500

SCOPe Domain Sequences for d1ye5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ye5a_ c.120.1.1 (A:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 53953]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelm

SCOPe Domain Coordinates for d1ye5a_:

Click to download the PDB-style file with coordinates for d1ye5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ye5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ye5b_