Lineage for d1ydyb_ (1ydy B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448305Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2448365Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins)
    Pfam PF03009
  6. 2448366Protein Glycerophosphodiester phosphodiesterase GlpQ [110382] (1 species)
  7. 2448367Species Escherichia coli [TaxId:562] [110383] (2 PDB entries)
    Uniprot P09394
  8. 2448373Domain d1ydyb_: 1ydy B: [123007]
    automated match to d1t8qb_
    complexed with ca, gol

Details for d1ydyb_

PDB Entry: 1ydy (more details), 1.7 Å

PDB Description: crystal structure of periplasmic glycerophosphodiester phosphodiesterase from escherichia coli
PDB Compounds: (B:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d1ydyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydyb_ c.1.18.3 (B:) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]}
nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv
adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf
eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq
cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk
qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn
qlydalynkagvnglftdfpdkavkfln

SCOPe Domain Coordinates for d1ydyb_:

Click to download the PDB-style file with coordinates for d1ydyb_.
(The format of our PDB-style files is described here.)

Timeline for d1ydyb_: