![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
![]() | Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins) Pfam PF03009 |
![]() | Protein Glycerophosphodiester phosphodiesterase GlpQ [110382] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110383] (2 PDB entries) Uniprot P09394 |
![]() | Domain d1ydyb_: 1ydy B: [123007] automated match to d1t8qb_ complexed with ca, gol |
PDB Entry: 1ydy (more details), 1.7 Å
SCOPe Domain Sequences for d1ydyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydyb_ c.1.18.3 (B:) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]} nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn qlydalynkagvnglftdfpdkavkfln
Timeline for d1ydyb_: