Lineage for d1ydua1 (1ydu A:2-170)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 681017Fold b.162: At5g01610-like [141561] (1 superfamily)
    contains large meander beta-sheet bent into a scoop-like shape
  4. 681018Superfamily b.162.1: At5g01610-like [141562] (1 family) (S)
  5. 681019Family b.162.1.1: At5g01610-like [141563] (1 protein)
    Pfam PF04398; DUF538
  6. 681020Protein Hypothetical protein At5g01610 [141564] (1 species)
  7. 681021Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141565] (1 PDB entry)
  8. 681022Domain d1ydua1: 1ydu A:2-170 [123003]
    mutant

Details for d1ydua1

PDB Entry: 1ydu (more details)

PDB Description: solution nmr structure of at5g01610, an arabidopsis thaliana protein containing duf538 domain
PDB Compounds: (A:) At5g01610

SCOP Domain Sequences for d1ydua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydua1 b.162.1.1 (A:2-170) Hypothetical protein At5g01610 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dqifnkvgsywlgqkankqfdsvgndlnsvstsieggtkwlvnkikgkmqkplpellkey
dlpigifpgdatnyefdeetkkltvlipsicevgykdssvlkftttvtghlekgkltdve
giktkvmiwvkvtsistdaskvyftagmkksrsrdaygvqrnglrvdkf

SCOP Domain Coordinates for d1ydua1:

Click to download the PDB-style file with coordinates for d1ydua1.
(The format of our PDB-style files is described here.)

Timeline for d1ydua1: