| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.295: TFB5-like [142896] (1 superfamily) beta-alpha-beta(2)-alpha; 2 layers, a/b; antiparallel sheet, order: 132; dimerises in solution (PDB 2jnj) via extended N-terminal strand |
Superfamily d.295.1: TFB5-like [142897] (2 families) ![]() |
| Family d.295.1.1: TFB5-like [142898] (1 protein) Pfam PF06331 |
| Protein General transcription factor IIH polypeptide 5, TFB5 [142899] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [142900] (1 PDB entry) Uniprot Q6ZYL4 6-71 |
| Domain d1ydla1: 1ydl A:6-71 [123001] |
PDB Entry: 1ydl (more details), 2.3 Å
SCOPe Domain Sequences for d1ydla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydla1 d.295.1.1 (A:6-71) General transcription factor IIH polypeptide 5, TFB5 {Human (Homo sapiens) [TaxId: 9606]}
kgmliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqervgelmdqna
fsltqk
Timeline for d1ydla1: