Lineage for d1ydka1 (1ydk A:81-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996627Protein Class alpha GST [81349] (8 species)
  7. 1996640Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries)
    Uniprot P08263
  8. 1996661Domain d1ydka1: 1ydk A:81-209 [122997]
    Other proteins in same PDB: d1ydka2, d1ydkb2
    automated match to d1k3ya1
    complexed with gtx; mutant

Details for d1ydka1

PDB Entry: 1ydk (more details), 1.95 Å

PDB Description: Crystal structure of the I219A mutant of human glutathione transferase A1-1 with S-hexylglutathione
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1ydka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydka1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

SCOPe Domain Coordinates for d1ydka1:

Click to download the PDB-style file with coordinates for d1ydka1.
(The format of our PDB-style files is described here.)

Timeline for d1ydka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ydka2